Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.2: Virus ectodomain [58069] (1 family) |
Family h.3.2.1: Virus ectodomain [58070] (9 proteins) |
Protein Core structure of Ebo gp2 [58076] (1 species) |
Species Ebola virus [TaxId:205488] [58077] (2 PDB entries) |
Domain d2eboc_: 2ebo C: [45756] complexed with cl |
PDB Entry: 2ebo (more details), 1.9 Å
SCOPe Domain Sequences for d2eboc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eboc_ h.3.2.1 (C:) Core structure of Ebo gp2 {Ebola virus [TaxId: 205488]} glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt knitdkidqiihdf
Timeline for d2eboc_: