PDB entry 2ebo

View 2ebo on RCSB PDB site
Description: core structure of gp2 from ebola virus
Class: envelope glycoprotein
Keywords: envelope glycoprotein, filovirus, ebola virus, gp2, coat protein
Deposited on 1998-12-24, released 1999-05-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ebola virus envelope glycoprotein
    Species: Zaire ebolavirus - Mayinga (Zaire, 1976) [TaxId:128952]
    Gene: GP41
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05320 (0-73)
      • mutation (52)
    Domains in SCOPe 2.01: d2eboa_
  • Chain 'B':
    Compound: ebola virus envelope glycoprotein
    Species: Zaire ebolavirus - Mayinga (Zaire, 1976) [TaxId:128952]
    Gene: GP41
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05320 (0-73)
      • mutation (52)
    Domains in SCOPe 2.01: d2ebob_
  • Chain 'C':
    Compound: ebola virus envelope glycoprotein
    Species: Zaire ebolavirus - Mayinga (Zaire, 1976) [TaxId:128952]
    Gene: GP41
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05320 (0-73)
      • mutation (52)
    Domains in SCOPe 2.01: d2eboc_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2eboA (A:)
glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
knitdkidqiihdf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2eboB (B:)
glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
knitdkidqiihdf

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2eboC (C:)
glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
knitdkidqiihdf