![]() | Class g: Small proteins [56992] (66 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (12 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (3 families) ![]() |
![]() | Family g.41.5.2: Desulforedoxin [57813] (2 proteins) |
![]() | Protein Desulfoferrodoxin N-terminal domain [57816] (1 species) |
![]() | Species Desulfovibrio desulfuricans [TaxId:876] [57817] (1 PDB entry) |
![]() | Domain d1dfx_2: 1dfx 1-36 [45255] Other proteins in same PDB: d1dfx_1 complexed with ca, fe |
PDB Entry: 1dfx (more details), 1.9 Å
SCOP Domain Sequences for d1dfx_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfx_2 g.41.5.2 (1-36) Desulfoferrodoxin N-terminal domain {Desulfovibrio desulfuricans} pkhlevykcthcgnivevlhgggaelvccgepmkhm
Timeline for d1dfx_2: