Lineage for d1dfx_2 (1dfx 1-36)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 344238Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 344326Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 344381Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
  6. 344382Protein Desulfoferrodoxin N-terminal domain [57816] (1 species)
  7. 344383Species Desulfovibrio desulfuricans [TaxId:876] [57817] (1 PDB entry)
  8. 344384Domain d1dfx_2: 1dfx 1-36 [45255]
    Other proteins in same PDB: d1dfx_1
    complexed with ca, fe

Details for d1dfx_2

PDB Entry: 1dfx (more details), 1.9 Å

PDB Description: desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774

SCOP Domain Sequences for d1dfx_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfx_2 g.41.5.2 (1-36) Desulfoferrodoxin N-terminal domain {Desulfovibrio desulfuricans}
pkhlevykcthcgnivevlhgggaelvccgepmkhm

SCOP Domain Coordinates for d1dfx_2:

Click to download the PDB-style file with coordinates for d1dfx_2.
(The format of our PDB-style files is described here.)

Timeline for d1dfx_2:

344384
d1dfx_2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1dfx_1