Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (1 family) |
Family b.1.13.1: Superoxide reductase-like [49368] (2 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins |
Protein Desulfoferrodoxin C-terminal domain [49371] (1 species) |
Species Desulfovibrio desulfuricans [TaxId:876] [49372] (1 PDB entry) |
Domain d1dfx_1: 1dfx 37-125 [22367] Other proteins in same PDB: d1dfx_2 complexed with ca, fe |
PDB Entry: 1dfx (more details), 1.9 Å
SCOP Domain Sequences for d1dfx_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfx_1 b.1.13.1 (37-125) Desulfoferrodoxin C-terminal domain {Desulfovibrio desulfuricans} vegstdgamekhvpviekvdggylikvgsvphpmeekhwiewielladgrsytkflkpgd apeaffaidaskvtareycnlhghwkaen
Timeline for d1dfx_1: