SCOP 1.65: Domain d1dfx_1: 1dfx 37-125

Lineage for d1dfx_1 (1dfx 37-125)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (1 family)

5. Family b.1.13.1: Superoxide reductase-like [49368] (2 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins

6. Protein Desulfoferrodoxin C-terminal domain [49371] (1 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [49372] (1 PDB entry)

8. Domain d1dfx_1: 1dfx 37-125 [22367]
   Other proteins in same PDB: d1dfx_2
   complexed with ca, fe

Details for d1dfx_1

PDB Entry: 1dfx, 1.9 Å

PDB Description: desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774

SCOP Domain Sequences for d1dfx_1:

Sequence; same for both SEQRES and ATOM records:

>d1dfx_1 b.1.13.1 (37-125) Desulfoferrodoxin C-terminal domain {Desulfovibrio desulfuricans}
vegstdgamekhvpviekvdggylikvgsvphpmeekhwiewielladgrsytkflkpgd
apeaffaidaskvtareycnlhghwkaen

Timeline for d1dfx_1:

• d1dfx_1 first appeared (with stable ids) in SCOP 1.55
  
• d1dfx_1 appears in SCOP 1.63
  
• d1dfx_1 appears in SCOP 1.67
  
• d1dfx_1 appears in the current release, SCOPe 2.08, called d1dfxa1