PDB entry 1dfx

View 1dfx on RCSB PDB site
Description: desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774
Deposited on 1997-09-03, released 1998-10-14
The last revision prior to the SCOP 1.65 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dfx_ (-)
pkhlevykcthcgnivevlhgggaelvccgepmkhmvegstdgamekhvpviekvdggyl
ikvgsvphpmeekhwiewielladgrsytkflkpgdapeaffaidaskvtareycnlhgh
wkaen