Lineage for d1zmec1 (1zme C:31-66)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262205Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 2262206Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repeats are related by the pseudo dyad
  5. 2262207Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 2262241Protein PUT3 [57707] (1 species)
  7. 2262242Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57708] (2 PDB entries)
  8. 2262243Domain d1zmec1: 1zme C:31-66 [45081]
    Other proteins in same PDB: d1zmec2, d1zmed2
    protein/DNA complex; complexed with zn

Details for d1zmec1

PDB Entry: 1zme (more details), 2.5 Å

PDB Description: crystal structure of put3/dna complex
PDB Compounds: (C:) proline utilization transcription activator

SCOPe Domain Sequences for d1zmec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmec1 g.38.1.1 (C:31-66) PUT3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svaclscrkrhikcpggnpcqkcvtsnaiceyleps

SCOPe Domain Coordinates for d1zmec1:

Click to download the PDB-style file with coordinates for d1zmec1.
(The format of our PDB-style files is described here.)

Timeline for d1zmec1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zmec2