Class g: Small proteins [56992] (94 folds) |
Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily) all-alpha dimetal(zinc)-bound fold |
Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) duplication: two structural repeats are related by the pseudo dyad |
Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins) |
Protein PUT3 [57707] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57708] (2 PDB entries) |
Domain d1zmec1: 1zme C:31-66 [45081] Other proteins in same PDB: d1zmec2, d1zmed2 protein/DNA complex; complexed with zn |
PDB Entry: 1zme (more details), 2.5 Å
SCOPe Domain Sequences for d1zmec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zmec1 g.38.1.1 (C:31-66) PUT3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} svaclscrkrhikcpggnpcqkcvtsnaiceyleps
Timeline for d1zmec1: