SCOPe 2.07: Domain d1zmec1: 1zme C:31-66

Lineage for d1zmec1 (1zme C:31-66)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
   all-alpha dimetal(zinc)-bound fold

4. Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family)
   duplication: two structural repeats are related by the pseudo dyad

5. Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)

6. Protein PUT3 [57707] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57708] (2 PDB entries)

8. Domain d1zmec1: 1zme C:31-66 [45081]
   Other proteins in same PDB: d1zmec2, d1zmed2
   protein/DNA complex; complexed with zn

Details for d1zmec1

PDB Entry: 1zme, 2.5 Å

PDB Description: crystal structure of put3/dna complex

PDB Compounds: (C:) proline utilization transcription activator

SCOPe Domain Sequences for d1zmec1:

Sequence; same for both SEQRES and ATOM records:

>d1zmec1 g.38.1.1 (C:31-66) PUT3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svaclscrkrhikcpggnpcqkcvtsnaiceyleps

Timeline for d1zmec1:

• d1zmec1 first appeared (with stable ids) in SCOP 1.55
  
• d1zmec1 appears in SCOPe 2.06
  
• d1zmec1 appears in the current release, SCOPe 2.08