SCOPe 2.06: Domain d1d2la_: 1d2l A:

Lineage for d1d2la_ (1d2l A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.12: LDL receptor-like module [57423] (1 superfamily)
   disulfide-rich calcium-binding fold

4. Superfamily g.12.1: LDL receptor-like module [57424] (2 families)

5. Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)

6. Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57427] (13 PDB entries)
   Uniprot P01130 272-353

8. Domain d1d2la_: 1d2l A: [44614]
   complement-like repeat cr3
   complexed with ca

Details for d1d2la_

PDB Entry: 1d2l

PDB Description: nmr solution structure of complement-like repeat cr3 from the low density lipoprotein receptor-related protein (lrp). evidence for specific binding to the receptor binding domain of human alpha-2 macroglobulin

PDB Compounds: (A:) lipoprotein receptor related protein

SCOPe Domain Sequences for d1d2la_:

Sequence; same for both SEQRES and ATOM records:

>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
gsppqcqpgefacansrciqerwkcdgdndcldnsdeapalchqh

Timeline for d1d2la_:

• d1d2la_ first appeared (with stable ids) in SCOP 1.55
  
• d1d2la_ appears in SCOPe 2.05
  
• d1d2la_ appears in SCOPe 2.07
  
• d1d2la_ appears in the current release, SCOPe 2.08, called d1d2la1