Lineage for d1d2la1 (1d2l A:3-45)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033148Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 3033149Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. 3033150Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)
  6. 3033160Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 3033161Species Human (Homo sapiens) [TaxId:9606] [57427] (14 PDB entries)
    Uniprot P01130 272-353
  8. 3033173Domain d1d2la1: 1d2l A:3-45 [44614]
    Other proteins in same PDB: d1d2la2
    complement-like repeat cr3
    complexed with ca

Details for d1d2la1

PDB Entry: 1d2l (more details)

PDB Description: nmr solution structure of complement-like repeat cr3 from the low density lipoprotein receptor-related protein (lrp). evidence for specific binding to the receptor binding domain of human alpha-2 macroglobulin
PDB Compounds: (A:) lipoprotein receptor related protein

SCOPe Domain Sequences for d1d2la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2la1 g.12.1.1 (A:3-45) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
ppqcqpgefacansrciqerwkcdgdndcldnsdeapalchqh

SCOPe Domain Coordinates for d1d2la1:

Click to download the PDB-style file with coordinates for d1d2la1.
(The format of our PDB-style files is described here.)

Timeline for d1d2la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d2la2