Lineage for d1pgeb2 (1pge B:33-73)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 202990Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 202991Family g.3.11.1: EGF-type module [57197] (18 proteins)
  6. 203116Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
  7. 203142Species Sheep (Ovis aries) [TaxId:9940] [57211] (15 PDB entries)
  8. 203157Domain d1pgeb2: 1pge B:33-73 [44251]
    Other proteins in same PDB: d1pgea1, d1pgeb1

Details for d1pgeb2

PDB Entry: 1pge (more details), 3.5 Å

PDB Description: prostaglandin h2 synthase-1 complexed with p-(2'-iodo-5'-thenoyl) hydrotropic acid (iodosuprofen)

SCOP Domain Sequences for d1pgeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgeb2 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries)}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOP Domain Coordinates for d1pgeb2:

Click to download the PDB-style file with coordinates for d1pgeb2.
(The format of our PDB-style files is described here.)

Timeline for d1pgeb2:

203157
d1pgeb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1pgeb1