SCOP 1.63: Domain d1pgeb2: 1pge B:33-73

Lineage for d1pgeb2 (1pge B:33-73)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
   disulphide-bound fold; contains beta-hairpin with two adjacent disulphides

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (18 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Sheep (Ovis aries) [TaxId:9940] [57211] (15 PDB entries)

8. Domain d1pgeb2: 1pge B:33-73 [44251]
   Other proteins in same PDB: d1pgea1, d1pgeb1
   complexed with bog, hem, isf, nag

Details for d1pgeb2

PDB Entry: 1pge, 3.5 Å

PDB Description: prostaglandin h2 synthase-1 complexed with p-(2'-iodo-5'-thenoyl) hydrotropic acid (iodosuprofen)

SCOP Domain Sequences for d1pgeb2:

Sequence; same for both SEQRES and ATOM records:

>d1pgeb2 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries)}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d1pgeb2:

• d1pgeb2 first appeared (with stable ids) in SCOP 1.55
  
• d1pgeb2 appears in SCOP 1.61
  
• d1pgeb2 appears in SCOP 1.65
  
• d1pgeb2 appears in the current release, SCOPe 2.08