SCOPe 2.08: Domain d1whea1: 1whe A:47-86

Lineage for d1whea1 (1whe A:47-86)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Factor X, N-terminal module [57205] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries)

8. Domain d1whea1: 1whe A:47-86 [44242]
   Other proteins in same PDB: d1whea2

Details for d1whea1

PDB Entry: 1whe

PDB Description: coagulation factor, nmr, 20 structures

PDB Compounds: (A:) coagulation factor x

SCOPe Domain Sequences for d1whea1:

Sequence; same for both SEQRES and ATOM records:

>d1whea1 g.3.11.1 (A:47-86) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}
gdqceghpclnqghckdgigdytctcaegfegkncefstr

Timeline for d1whea1:

• d1whea1 first appeared (with stable ids) in SCOP 1.55, called d1whe_1
  
• d1whea1 appears in SCOPe 2.07