Lineage for d1whe_1 (1whe 47-86)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 40011Protein Factor X, N-terminal module [57205] (2 species)
  7. 40012Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries)
  8. 40016Domain d1whe_1: 1whe 47-86 [44242]
    Other proteins in same PDB: d1whe_2

Details for d1whe_1

PDB Entry: 1whe (more details)

PDB Description: coagulation factor, nmr, 20 structures

SCOP Domain Sequences for d1whe_1:

Sequence, based on SEQRES records: (download)

>d1whe_1 g.3.11.1 (47-86) Factor X, N-terminal module {Cow (Bos taurus)}
gdqceghpclnqghckxgigdytctcaegfegkncefstr

Sequence, based on observed residues (ATOM records): (download)

>d1whe_1 g.3.11.1 (47-86) Factor X, N-terminal module {Cow (Bos taurus)}
gdqceghpclnqghckgigdytctcaegfegkncefstr

SCOP Domain Coordinates for d1whe_1:

Click to download the PDB-style file with coordinates for d1whe_1.
(The format of our PDB-style files is described here.)

Timeline for d1whe_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1whe_2