Lineage for d1ffta_ (1fft A:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060234Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 1060235Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 1060236Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 1060259Protein Cytochrome O ubiquinol oxidase, subunit I [81440] (1 species)
  7. 1060260Species Escherichia coli [TaxId:562] [81439] (1 PDB entry)
  8. 1060261Domain d1ffta_: 1fft A: [43627]
    Other proteins in same PDB: d1fftb1, d1fftb2, d1fftc_, d1fftg1, d1fftg2, d1ffth_
    complexed with cu, hem, heo

Details for d1ffta_

PDB Entry: 1fft (more details), 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli
PDB Compounds: (A:) ubiquinol oxidase

SCOPe Domain Sequences for d1ffta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffta_ f.24.1.1 (A:) Cytochrome O ubiquinol oxidase, subunit I {Escherichia coli [TaxId: 562]}
vdhkrlgimyiivaivmllrgfadaimmrsqqalasageagflpphhydqiftahgvimi
ffvampfviglmnlvvplqigardvafpflnnlsfwftvvgvilvnvslgvgefaqtgwl
aypplsgieyspgvgvdywiwslqlsgigttltginffvtilkmrapgmtmfkmpvftwa
slcanvliiasfpiltvtvalltldrylgthfftndmggnmmmyinliwawghpevyili
lpvfgvfseiaatfsrkrlfgytslvwatvcitvlsfivwlhhfftmgaganvnaffgit
tmiiaiptgvkifnwlftmyqgrivfhsamlwtigfivtfsvggmtgvllavpgadfvlh
nslfliahfhnviiggvvfgcfagmtywwpkafgfklnetwgkrafwfwiigffvafmpl
yalgfmgmtrrlsqqidpqfhtmlmiaasgavlialgilclviqmyvsirdrdqnrdltg
dpwggrtlewatsspppfynf

SCOPe Domain Coordinates for d1ffta_:

Click to download the PDB-style file with coordinates for d1ffta_.
(The format of our PDB-style files is described here.)

Timeline for d1ffta_: