SCOP 1.63: Domain d1ocox_: 1oco X:

Lineage for d1ocox_ (1oco X:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
   not a true fold

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81420] (5 PDB entries)

8. Domain d1ocox_: 1oco X: [43615]
   Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocoy_, d1ocoz_
   complexed with cmo, cu, hea, mg, na, zn

Details for d1ocox_

PDB Entry: 1oco, 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

SCOP Domain Sequences for d1ocox_:

Sequence; same for both SEQRES and ATOM records:

>d1ocox_ f.23.5.1 (X:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus)}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d1ocox_:

• d1ocox_ first appeared (with stable ids) in SCOP 1.55, called d1ocox1
  
• d1ocox_ was called d1ocox1 in SCOP 1.61
  
• d1ocox_ appears in SCOP 1.65
  
• d1ocox_ appears in the current release, SCOPe 2.08