Lineage for d1oczx_ (1ocz X:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025247Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 3025248Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 3025249Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025250Species Cow (Bos taurus) [TaxId:9913] [81420] (33 PDB entries)
  8. 3025297Domain d1oczx_: 1ocz X: [43595]
    Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczy_, d1oczz_
    complexed with azi, cu, hea, mg, na, zn

Details for d1oczx_

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state
PDB Compounds: (X:) cytochrome c oxidase

SCOPe Domain Sequences for d1oczx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczx_ f.23.5.1 (X:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d1oczx_:

Click to download the PDB-style file with coordinates for d1oczx_.
(The format of our PDB-style files is described here.)

Timeline for d1oczx_: