Lineage for d1oczc_ (1ocz C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027151Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 3027152Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 3027153Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 3027166Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 3027167Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)
  8. 3027261Domain d1oczc_: 1ocz C: [43580]
    Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczd_, d1ocze_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczq_, d1oczr_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_
    complexed with azi, cu, hea, mg, na, zn

Details for d1oczc_

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state
PDB Compounds: (C:) cytochrome c oxidase

SCOPe Domain Sequences for d1oczc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeagaw
ywhfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d1oczc_:

Click to download the PDB-style file with coordinates for d1oczc_.
(The format of our PDB-style files is described here.)

Timeline for d1oczc_: