Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (13 families) |
Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins) |
Protein Cytochrome c oxidase [56884] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [56885] (5 PDB entries) |
Domain d1oczp1: 1ocz P: [43590] Other proteins in same PDB: d1oczb1, d1ocze_, d1oczf_, d1oczh_, d1oczo1, d1oczr_, d1oczs_, d1oczu_ |
PDB Entry: 1ocz (more details), 2.9 Å
SCOP Domain Sequences for d1oczp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oczp1 f.2.1.3 (P:) Cytochrome c oxidase {Cow (Bos taurus)} mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeagaw ywhfvdvvwlflyvsiywwgs
Timeline for d1oczp1:
View in 3D Domains from other chains: (mouse over for more information) d1ocza1, d1oczb1, d1oczb2, d1oczc1, d1oczd1, d1ocze_, d1oczf_, d1oczg1, d1oczh_, d1oczi1, d1oczj1, d1oczk1, d1oczl1, d1oczm1, d1oczn1, d1oczo1, d1oczo2, d1oczq1, d1oczr_, d1oczs_, d1oczt1, d1oczu_, d1oczv1, d1oczw1, d1oczx1, d1oczy1, d1oczz1 |