Lineage for d1oczf_ (1ocz F:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204875Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 204959Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 205024Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
  6. 205025Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 205026Species Cow (Bos taurus) [TaxId:9913] [57820] (5 PDB entries)
  8. 205033Domain d1oczf_: 1ocz F: [45262]
    Other proteins in same PDB: d1ocza1, d1oczb1, d1oczb2, d1oczc1, d1oczd1, d1ocze_, d1oczg1, d1oczh_, d1oczi1, d1oczj1, d1oczk1, d1oczl1, d1oczm1, d1oczn1, d1oczo1, d1oczo2, d1oczp1, d1oczq1, d1oczr_, d1oczt1, d1oczu_, d1oczv1, d1oczw1, d1oczx1, d1oczy1, d1oczz1

Details for d1oczf_

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

SCOP Domain Sequences for d1oczf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus)}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOP Domain Coordinates for d1oczf_:

Click to download the PDB-style file with coordinates for d1oczf_.
(The format of our PDB-style files is described here.)

Timeline for d1oczf_: