Lineage for d7prcm_ (7prc M:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1698958Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1698959Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1698960Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1699045Protein M (medium) subunit [81481] (3 species)
  7. 1699115Species Rhodopseudomonas viridis [TaxId:1079] [81478] (10 PDB entries)
  8. 1699123Domain d7prcm_: 7prc M: [43453]
    Other proteins in same PDB: d7prcc_, d7prch1, d7prch2, d7prcl_
    complexed with bcb, bpb, cet, fe2, hem, lda, mq7, ns5, so4

Details for d7prcm_

PDB Entry: 7prc (more details), 2.65 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420315 (triazine) complex)
PDB Compounds: (M:) photosynthetic reaction center

SCOPe Domain Sequences for d7prcm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

SCOPe Domain Coordinates for d7prcm_:

Click to download the PDB-style file with coordinates for d7prcm_.
(The format of our PDB-style files is described here.)

Timeline for d7prcm_: