SCOPe 2.03: Domain d7prcm_: 7prc M:

Lineage for d7prcm_ (7prc M:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81478] (10 PDB entries)

8. Domain d7prcm_: 7prc M: [43453]
   Other proteins in same PDB: d7prcc_, d7prch1, d7prch2, d7prcl_
   complexed with bcb, bpb, cet, fe2, hem, lda, mq7, ns5, so4

Details for d7prcm_

PDB Entry: 7prc, 2.65 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420315 (triazine) complex)

PDB Compounds: (M:) photosynthetic reaction center

SCOPe Domain Sequences for d7prcm_:

Sequence; same for both SEQRES and ATOM records:

>d7prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d7prcm_:

• d7prcm_ first appeared (with stable ids) in SCOP 1.55, called d7prcm1
  
• d7prcm_ appears in SCOPe 2.02
  
• d7prcm_ appears in SCOPe 2.04
  
• d7prcm_ appears in the current release, SCOPe 2.08