Lineage for d7prch1 (7prc H:37-258)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1542883Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1542884Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1542885Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1542886Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1542979Species Rhodopseudomonas viridis [TaxId:1079] [50349] (15 PDB entries)
  8. 1542992Domain d7prch1: 7prc H:37-258 [25463]
    Other proteins in same PDB: d7prcc_, d7prch2, d7prcl_, d7prcm_
    complexed with bcb, bpb, cet, fe2, hem, lda, mq7, ns5, so4

Details for d7prch1

PDB Entry: 7prc (more details), 2.65 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420315 (triazine) complex)
PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d7prch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7prch1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d7prch1:

Click to download the PDB-style file with coordinates for d7prch1.
(The format of our PDB-style files is described here.)

Timeline for d7prch1: