Lineage for d3prcl_ (3prc L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027283Protein L (light) subunit [81477] (4 species)
  7. 3027358Species Rhodopseudomonas viridis [TaxId:1079] [81474] (21 PDB entries)
  8. 3027362Domain d3prcl_: 3prc L: [43437]
    Other proteins in same PDB: d3prcc_, d3prch1, d3prch2, d3prch3, d3prcm_
    complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4

Details for d3prcl_

PDB Entry: 3prc (more details), 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (qb-depleted)
PDB Compounds: (L:) photosynthetic reaction center

SCOPe Domain Sequences for d3prcl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

SCOPe Domain Coordinates for d3prcl_:

Click to download the PDB-style file with coordinates for d3prcl_.
(The format of our PDB-style files is described here.)

Timeline for d3prcl_: