SCOP 1.63: Domain d1bm1__: 1bm1 -

Lineage for d1bm1__ (1bm1 -)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families)

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (3 proteins)

6. Protein Bacteriorhodopsin [56871] (2 species)
   a light-driven proton pump

7. Species Archaeon Halobacterium halobium [TaxId:2242] [56872] (3 PDB entries)

8. Domain d1bm1__: 1bm1 - [43402]
   complexed with dpg, ret

Details for d1bm1__

PDB Entry: 1bm1, 3.5 Å

PDB Description: crystal structure of bacteriorhodopsin in the light-adapted state

SCOP Domain Sequences for d1bm1__:

Sequence; same for both SEQRES and ATOM records:

>d1bm1__ f.13.1.1 (-) Bacteriorhodopsin {Archaeon Halobacterium halobium}
rpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygl
tmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvga
ltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsayp
vvwligsegagivplnietllfmvldvsakvgfglillrsr

Timeline for d1bm1__:

• d1bm1__ first appeared (with stable ids) in SCOP 1.55
  
• d1bm1__ appears in SCOP 1.61
  
• d1bm1__ appears in SCOP 1.65
  
• d1bm1__ appears in the current release, SCOPe 2.08, called d1bm1a_