SCOPe 2.08: Domain d2bida1: 2bid A:3-197

Lineage for d2bida1 (2bid A:3-197)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Proapoptotic molecule Bid [56859] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56860] (1 PDB entry)

8. Domain d2bida1: 2bid A:3-197 [43398]
   Other proteins in same PDB: d2bida2
   has additional insertions and/or extensions that are not grouped together

Details for d2bida1

PDB Entry: 2bid

PDB Description: human pro-apoptotic protein bid

PDB Compounds: (A:) protein (bid)

SCOPe Domain Sequences for d2bida1:

Sequence; same for both SEQRES and ATOM records:

>d2bida1 f.1.4.1 (A:3-197) Proapoptotic molecule Bid {Human (Homo sapiens) [TaxId: 9606]}
mdcevnngsslrdecitnllvfgflqscsdnsfrreldalghelpvlapqwegydelqtd
gnrsshsrlgrieadsesqediirniarhlaqvgdsmdrsippglvnglalqlrntsrse
edrnrdlataleqllqayprdmekektmlvlalllakkvashtpsllrdvfhttvnfinq
nlrtyvrslarngmd

Timeline for d2bida1:

• d2bida1 first appeared (with stable ids) in SCOP 1.55, called d2bida_
  
• d2bida1 was called d2bida_ in SCOPe 2.07