Lineage for d8f0ab1 (8f0a B:12-259)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794694Protein Protease Do (DegP, HtrA), catalytic domain [74969] (2 species)
  7. 2794695Species Escherichia coli [TaxId:562] [74970] (5 PDB entries)
  8. 3087123Domain d8f0ab1: 8f0a B:12-259 [423440]
    Other proteins in same PDB: d8f0aa2, d8f0ab2, d8f0ac2
    automated match to d3cs0a3

Details for d8f0ab1

PDB Entry: 8f0a (more details), 2.6 Å

PDB Description: client-bound structure of a degp trimer within a 12mer cage
PDB Compounds: (B:) periplasmic serine endoprotease degp

SCOPe Domain Sequences for d8f0ab1:

Sequence, based on SEQRES records: (download)

>d8f0ab1 b.47.1.1 (B:12-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]}
mpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqegspfqsspfcqg
gqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdgrkfdakmvgkd
prsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsgivsalgrsgln
aenyenfiqtdaainrgnaggalvnlngeligintailapdggnigigfaipsnmvknlt
sqmveygq

Sequence, based on observed residues (ATOM records): (download)

>d8f0ab1 b.47.1.1 (B:12-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]}
mpslapmlekvmpsvvsinvegstqkfmalgsgviidadkgyvvtnnhvvdnatvikvql
sdgrkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetv
tsgivsalgrsglnaenyenfiqtdaainrgnaggalvnlngeligintailapdggnig
igfaipsnmvknltsqmveygq

SCOPe Domain Coordinates for d8f0ab1:

Click to download the PDB-style file with coordinates for d8f0ab1.
(The format of our PDB-style files is described here.)

Timeline for d8f0ab1:

  • d8f0ab1 appears in periodic updates to SCOPe 2.08 starting on 2023-01-06