Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256270] (3 PDB entries) |
Domain d7ff9d2: 7ff9 D:143-211 [423049] Other proteins in same PDB: d7ff9a1, d7ff9b1, d7ff9c1, d7ff9d1, d7ff9e1, d7ff9g1 automated match to d2oz6a1 complexed with au, cl, cmp, so4 |
PDB Entry: 7ff9 (more details), 2.4 Å
SCOPe Domain Sequences for d7ff9d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ff9d2 a.4.5.0 (D:143-211) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} dvtgrvartlldlcqqpdamthpdgmqikitrqeigrivgcsremvgrvlksleeqglvh vkgktmvvf
Timeline for d7ff9d2: