Lineage for d7ff9d2 (7ff9 D:143-211)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694988Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256270] (3 PDB entries)
  8. 3086732Domain d7ff9d2: 7ff9 D:143-211 [423049]
    Other proteins in same PDB: d7ff9a1, d7ff9b1, d7ff9c1, d7ff9d1, d7ff9e1, d7ff9g1
    automated match to d2oz6a1
    complexed with au, cl, cmp, so4

Details for d7ff9d2

PDB Entry: 7ff9 (more details), 2.4 Å

PDB Description: pseudomonas aeruginosa virulence factor regulator with camp ligand and cl(triethylphosphine)gold(i)
PDB Compounds: (D:) cAMP-activated global transcriptional regulator Vfr

SCOPe Domain Sequences for d7ff9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ff9d2 a.4.5.0 (D:143-211) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
dvtgrvartlldlcqqpdamthpdgmqikitrqeigrivgcsremvgrvlksleeqglvh
vkgktmvvf

SCOPe Domain Coordinates for d7ff9d2:

Click to download the PDB-style file with coordinates for d7ff9d2.
(The format of our PDB-style files is described here.)

Timeline for d7ff9d2:

  • d7ff9d2 is new in SCOPe 2.08-stable