SCOPe 2.08: Domain d7ff9c1: 7ff9 C:13-142

Lineage for d7ff9c1 (7ff9 C:13-142)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (10 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [422998] (1 PDB entry)

8. Domain d7ff9c1: 7ff9 C:13-142 [423084]
   Other proteins in same PDB: d7ff9a2, d7ff9b2, d7ff9c2, d7ff9d2, d7ff9e2, d7ff9g2
   automated match to d2oz6a2
   complexed with au, cl, cmp, so4

Details for d7ff9c1

PDB Entry: 7ff9, 2.4 Å

PDB Description: pseudomonas aeruginosa virulence factor regulator with camp ligand and cl(triethylphosphine)gold(i)

PDB Compounds: (C:) cAMP-activated global transcriptional regulator Vfr

SCOPe Domain Sequences for d7ff9c1:

Sequence, based on SEQRES records:

>d7ff9c1 b.82.3.2 (C:13-142) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ldkllahchrrrytakstiiyagdrcetlffiikgsvtiliedddgremiigylnsgdff
gelglfekegseqersawvrakvecevaeisyakfrelsqqdseilytlgsqmadrlrkt
trkvgdlafl

Sequence, based on observed residues (ATOM records):

>d7ff9c1 b.82.3.2 (C:13-142) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ldkllahchrrrytakstiiyagdrcetlffiikgsvtiliedddgremiigylnsgdff
gelglfeseqersawvrakvecevaeisyakfrelsqqdseilytlgsqmadrlrkttrk
vgdlafl

Timeline for d7ff9c1:

• d7ff9c1 is new in SCOPe 2.08-stable