SCOPe 2.08: Domain d7wm7a2: 7wm7 A:533-642

Lineage for d7wm7a2 (7wm7 A:533-642)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.0: automated matches [227929] (1 protein)
   not a true family

6. Protein automated matches [227930] (6 species)
   not a true protein

7. Species Salmonella enterica [TaxId:1192560] [378975] (6 PDB entries)

8. Domain d7wm7a2: 7wm7 A:533-642 [422735]
   Other proteins in same PDB: d7wm7a1, d7wm7b1, d7wm7b3
   automated match to d6l2qa2
   protein/RNA complex; complexed with 9i6, zn

Details for d7wm7a2

PDB Entry: 7wm7, 2.4 Å

PDB Description: threonyl-trna synthetase from salmonella enterica in complex with an inhibitor

PDB Compounds: (A:) Threonine--tRNA ligase

SCOPe Domain Sequences for d7wm7a2:

Sequence; same for both SEQRES and ATOM records:

>d7wm7a2 c.51.1.0 (A:533-642) automated matches {Salmonella enterica [TaxId: 1192560]}
fptwlapvqvvvmnitdsqseyvneltqklqnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkeveagkvavrtrrgkdlgsldvndvieklqqeirsrslqqlee

Timeline for d7wm7a2:

• d7wm7a2 is new in SCOPe 2.08-stable