Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) |
Family c.51.1.0: automated matches [227929] (1 protein) not a true family |
Protein automated matches [227930] (6 species) not a true protein |
Species Salmonella enterica [TaxId:1192560] [378975] (6 PDB entries) |
Domain d6l2qa2: 6l2q A:533-642 [378976] Other proteins in same PDB: d6l2qa1, d6l2qa3, d6l2qb1, d6l2qb3 automated match to d1qf6a1 protein/RNA complex; complexed with e4o, edo, zn |
PDB Entry: 6l2q (more details), 2.3 Å
SCOPe Domain Sequences for d6l2qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l2qa2 c.51.1.0 (A:533-642) automated matches {Salmonella enterica [TaxId: 1192560]} fptwlapvqvvvmnitdsqseyvneltqklqnagirvkadlrnekigfkirehtlrrvpy mlvcgdkeveagkvavrtrrgkdlgsldvndvieklqqeirsrslqqlee
Timeline for d6l2qa2: