Lineage for d6l2qa2 (6l2q A:533-642)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2881871Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2881990Family c.51.1.0: automated matches [227929] (1 protein)
    not a true family
  6. 2881991Protein automated matches [227930] (6 species)
    not a true protein
  7. 2882028Species Salmonella enterica [TaxId:1192560] [378975] (6 PDB entries)
  8. 2882035Domain d6l2qa2: 6l2q A:533-642 [378976]
    Other proteins in same PDB: d6l2qa1, d6l2qa3, d6l2qb1, d6l2qb3
    automated match to d1qf6a1
    protein/RNA complex; complexed with e4o, edo, zn

Details for d6l2qa2

PDB Entry: 6l2q (more details), 2.3 Å

PDB Description: threonyl-trna synthetase from salmonella enterica in complex with an inhibitor
PDB Compounds: (A:) Threonine--tRNA ligase

SCOPe Domain Sequences for d6l2qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l2qa2 c.51.1.0 (A:533-642) automated matches {Salmonella enterica [TaxId: 1192560]}
fptwlapvqvvvmnitdsqseyvneltqklqnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkeveagkvavrtrrgkdlgsldvndvieklqqeirsrslqqlee

SCOPe Domain Coordinates for d6l2qa2:

Click to download the PDB-style file with coordinates for d6l2qa2.
(The format of our PDB-style files is described here.)

Timeline for d6l2qa2: