Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) duplication: contains two subdomains of this fold |
Family d.58.32.0: automated matches [227166] (1 protein) not a true family |
Protein automated matches [226875] (6 species) not a true protein |
Species Gulosibacter chungangensis [TaxId:979746] [422097] (1 PDB entry) |
Domain d7pbih2: 7pbi H:240-527 [422291] Other proteins in same PDB: d7pbia1, d7pbib1, d7pbic1, d7pbid1, d7pbie1, d7pbif1, d7pbig1, d7pbih1 automated match to d5fxda2 complexed with fad, h7y |
PDB Entry: 7pbi (more details), 2.8 Å
SCOPe Domain Sequences for d7pbih2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7pbih2 d.58.32.0 (H:240-527) automated matches {Gulosibacter chungangensis [TaxId: 979746]} pemlsfaiyfeneddlpaimettlplrigmaplqaapivrnvtfdaacvskreewqtepg pltdeakqrmvdelgighwivygtcygprwqidkyiemirdaylqipgarfetnetlplr egdrasellnarhelntgvpnrhsaavfdwfpnaghffyapvsapsgedaakqyedtkri sddhgidylaqfiiglremhhiclplydtadpasrketldmtreliragaeegygiyrah nvladqvaetysfnnhiqrrsherikdaldpngilnpgksgiwperlr
Timeline for d7pbih2: