Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) |
Family d.145.1.0: automated matches [191624] (1 protein) not a true family |
Protein automated matches [191143] (13 species) not a true protein |
Species Gulosibacter chungangensis [TaxId:979746] [422095] (1 PDB entry) |
Domain d7pbih1: 7pbi H:3-239 [422290] Other proteins in same PDB: d7pbia2, d7pbib2, d7pbic2, d7pbid2, d7pbie2, d7pbif2, d7pbig2, d7pbih2 automated match to d5fxda1 complexed with fad, h7y |
PDB Entry: 7pbi (more details), 2.8 Å
SCOPe Domain Sequences for d7pbih1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7pbih1 d.145.1.0 (H:3-239) automated matches {Gulosibacter chungangensis [TaxId: 979746]} frtlpdgvsaeqfanaisefsetigseyvrvdeatvseyddkfpvtdgdefkgsaviwpg stedvqvivriankygiplhafsggrnlgyggsspmltgtvllhlgkrmnrvleinekla yavvepgvdyktlyeavrdsgaklmidpaeldwgsvmgntmehgvgytpyadhsmwrcgm evvladgevlrtgmgglpgseawhlypgqlgpsieglfeqsnfgictrmgmqlmptp
Timeline for d7pbih1: