SCOPe 2.08: Domain d7pbih1: 7pbi H:3-239

Lineage for d7pbih1 (7pbi H:3-239)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.0: automated matches [191624] (1 protein)
   not a true family

6. Protein automated matches [191143] (13 species)
   not a true protein

7. Species Gulosibacter chungangensis [TaxId:979746] [422095] (1 PDB entry)

8. Domain d7pbih1: 7pbi H:3-239 [422290]
   Other proteins in same PDB: d7pbia2, d7pbib2, d7pbic2, d7pbid2, d7pbie2, d7pbif2, d7pbig2, d7pbih2
   automated match to d5fxda1
   complexed with fad, h7y

Details for d7pbih1

PDB Entry: 7pbi, 2.8 Å

PDB Description: 4-ethylphenol oxidase from gulosibacter chungangensis: isoeugenol complex

PDB Compounds: (H:) FAD-binding oxidoreductase

SCOPe Domain Sequences for d7pbih1:

Sequence; same for both SEQRES and ATOM records:

>d7pbih1 d.145.1.0 (H:3-239) automated matches {Gulosibacter chungangensis [TaxId: 979746]}
frtlpdgvsaeqfanaisefsetigseyvrvdeatvseyddkfpvtdgdefkgsaviwpg
stedvqvivriankygiplhafsggrnlgyggsspmltgtvllhlgkrmnrvleinekla
yavvepgvdyktlyeavrdsgaklmidpaeldwgsvmgntmehgvgytpyadhsmwrcgm
evvladgevlrtgmgglpgseawhlypgqlgpsieglfeqsnfgictrmgmqlmptp

Timeline for d7pbih1:

• d7pbih1 is new in SCOPe 2.08-stable