| Root: SCOPe 2.08 |
| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Kuruma prawn (Marsupenaeus japonicus) [TaxId:27405] [356321] (5 PDB entries) |
| Domain d7dqpc_: 7dqp C: [421391] automated match to d6a4ua_ |
PDB Entry: 7dqp (more details), 2.2 Å
SCOPe Domain Sequences for d7dqpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dqpc_ a.25.1.0 (C:) automated matches {Kuruma prawn (Marsupenaeus japonicus) [TaxId: 27405]}
asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
haqtfmkyqnkrggrivlqqiaapsmqewgtglealqaaldlekqvnqsllelhstasgn
ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln
Timeline for d7dqpc_: