Lineage for d7dqpn_ (7dqp N:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704249Species Kuruma prawn (Marsupenaeus japonicus) [TaxId:27405] [356321] (5 PDB entries)
  8. 3085234Domain d7dqpn_: 7dqp N: [421551]
    automated match to d6a4ua_

Details for d7dqpn_

PDB Entry: 7dqp (more details), 2.2 Å

PDB Description: thermal treated marsupenaeus japonicus ferritin
PDB Compounds: (N:) Ferritin

SCOPe Domain Sequences for d7dqpn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dqpn_ a.25.1.0 (N:) automated matches {Kuruma prawn (Marsupenaeus japonicus) [TaxId: 27405]}
asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
haqtfmkyqnkrggrivlqqiaapsmqewgtglealqaaldlekqvnqsllelhstasgn
ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln

SCOPe Domain Coordinates for d7dqpn_:

Click to download the PDB-style file with coordinates for d7dqpn_.
(The format of our PDB-style files is described here.)

Timeline for d7dqpn_:

  • d7dqpn_ is new in SCOPe 2.08-stable