Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311424] (13 PDB entries) |
Domain d7b12n_: 7b12 N: [420691] Other proteins in same PDB: d7b121_, d7b12a_, d7b12b_, d7b12d_, d7b12e_, d7b12f_, d7b12g_, d7b12i_, d7b12j_, d7b12k_, d7b12l_, d7b12m_, d7b12o_, d7b12p_, d7b12r_, d7b12s_, d7b12t_, d7b12u_, d7b12w_, d7b12x_, d7b12y_, d7b12z_ automated match to d7aweb_ complexed with na, skn, so4 |
PDB Entry: 7b12 (more details), 2.43 Å
SCOPe Domain Sequences for d7b12n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7b12n_ d.153.1.0 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tqnpmvtgtsvlgvkfeggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadf qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrd arsynrfqiatvtekgveiegplstetnwdiahm
Timeline for d7b12n_:
View in 3D Domains from other chains: (mouse over for more information) d7b121_, d7b122_, d7b12a_, d7b12b_, d7b12c_, d7b12d_, d7b12e_, d7b12f_, d7b12g_, d7b12h_, d7b12i_, d7b12j_, d7b12k_, d7b12l_, d7b12m_, d7b12o_, d7b12p_, d7b12q_, d7b12r_, d7b12s_, d7b12t_, d7b12u_, d7b12v_, d7b12w_, d7b12x_, d7b12y_, d7b12z_ |