Lineage for d7b12t_ (7b12 T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2990749Species Human (Homo sapiens) [TaxId:9606] [311422] (15 PDB entries)
  8. 3084221Domain d7b12t_: 7b12 T: [420538]
    Other proteins in same PDB: d7b121_, d7b122_, d7b12c_, d7b12d_, d7b12h_, d7b12i_, d7b12j_, d7b12k_, d7b12l_, d7b12m_, d7b12n_, d7b12q_, d7b12r_, d7b12v_, d7b12w_, d7b12x_, d7b12y_, d7b12z_
    automated match to d7awef_
    complexed with na, skn, so4

Details for d7b12t_

PDB Entry: 7b12 (more details), 2.43 Å

PDB Description: human immunoproteasome 20s particle in complex with [2-(3- ethylphenyl)-1-[(2s)-3-phenyl-2-[(pyrazin-2-yl) formamido]propanamido]ethyl]boronic acid
PDB Compounds: (T:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d7b12t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b12t_ d.153.1.4 (T:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
nqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqkki
lhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptqry
grrpygvglliagyddmgphifqtcpsanyfdcramsigarsqsartylerhmsefmecn
lnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegleer

SCOPe Domain Coordinates for d7b12t_:

Click to download the PDB-style file with coordinates for d7b12t_.
(The format of our PDB-style files is described here.)

Timeline for d7b12t_:

  • d7b12t_ is new in SCOPe 2.08-stable