Lineage for d7aafa1 (7aaf A:242-319)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) 
Family d.58.7.1: Canonical RBD [54929] (70 proteins)
Pfam PF00076
Pfam PF13893
Protein automated matches [190332] (5 species)
not a true protein
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311207] (4 PDB entries) 
Domain d7aafa1: 7aaf A:242-319 [420281]
Other proteins in same PDB: d7aafa2
automated match to d2u2fa_
Details for d7aafa1
PDB Entry: 7aaf (more details)
PDB Description: structural evolution of the tissue-specific u2af2 paralog and alternative splicing factor ls2
PDB Compounds: (A:) U2 snRNP auxiliary factor large subunitSCOPe Domain Sequences for d7aafa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7aafa1 d.58.7.1 (A:242-319) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
nkiyvgglptclnqdqvkellqsfgelkglnlvmdtntnlnkgfaffeycdpsvtdhaia
glhgmllgdrrlvvqrsi
SCOPe Domain Coordinates for d7aafa1:
Click to download the PDB-style file with coordinates for d7aafa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7aafa1:
- d7aafa1 is new in SCOPe 2.08-stable
View in 3D
