PDB entry 7aaf

View 7aaf on RCSB PDB site
Description: Structural evolution of the tissue-specific U2AF2 paralog and alternative splicing factor LS2
Class: RNA binding protein
Keywords: alternative splicing, structural biology, G quadruplex, U2AF, LS2, RRM RNA binding domain, RNA-protein interactions, RNA BINDING PROTEIN
Deposited on 2020-09-04, released 2021-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-10-06, with a file datestamp of 2021-10-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: U2 snRNP auxiliary factor large subunit
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: LS2, cg3162, DmelCG3162, CG3162, Dmel_CG3162
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9W1T4 (3-80)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d7aafa1, d7aafa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7aafA (A:)
  amgnkiyvgglptclnqdqvkellqsfgelkglnlvmdtntnlnkgfaffeycdpsvtdh
  aiaglhgmllgdrrlvvqrsi