Lineage for d1g0uh_ (1g0u H:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138489Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 138490Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 138590Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 138720Protein Proteasome beta subunit (catalytic) [56252] (2 species)
  7. 138736Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (4 PDB entries)
  8. 138753Domain d1g0uh_: 1g0u H: [41890]
    Other proteins in same PDB: d1g0ua_, d1g0ub_, d1g0uc_, d1g0ud_, d1g0ue_, d1g0uf_, d1g0ug_, d1g0uo_, d1g0up_, d1g0uq_, d1g0ur_, d1g0us_, d1g0ut_, d1g0uu_

Details for d1g0uh_

PDB Entry: 1g0u (more details), 2.4 Å

PDB Description: a gated channel into the proteasome core particle

SCOP Domain Sequences for d1g0uh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0uh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOP Domain Coordinates for d1g0uh_:

Click to download the PDB-style file with coordinates for d1g0uh_.
(The format of our PDB-style files is described here.)

Timeline for d1g0uh_: