Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily) |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein Proteasome beta subunit (catalytic) [56252] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (3 PDB entries) |
Domain d1rypi_: 1ryp I: [41877] Other proteins in same PDB: d1rypa_, d1rypb_, d1rypc_, d1rypd_, d1rype_, d1rypf_, d1rypg_, d1rypo_, d1rypp_, d1rypq_, d1rypr_, d1ryps_, d1rypt_, d1rypu_ |
PDB Entry: 1ryp (more details), 1.9 Å
SCOP Domain Sequences for d1rypi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae)} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d1rypi_:
View in 3D Domains from other chains: (mouse over for more information) d1ryp1_, d1ryp2_, d1rypa_, d1rypb_, d1rypc_, d1rypd_, d1rype_, d1rypf_, d1rypg_, d1ryph_, d1rypj_, d1rypk_, d1rypl_, d1rypm_, d1rypn_, d1rypo_, d1rypp_, d1rypq_, d1rypr_, d1ryps_, d1rypt_, d1rypu_, d1rypv_, d1rypw_, d1rypx_, d1rypy_, d1rypz_ |