Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein automated matches [190161] (29 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [188184] (14 PDB entries) |
Domain d7bh5a_: 7bh5 A: [417654] automated match to d1ylpa_ complexed with cl, na, tve |
PDB Entry: 7bh5 (more details), 1.55 Å
SCOPe Domain Sequences for d7bh5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bh5a_ e.3.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]} advqqklaelerqsggrlgvalintadnsqilyraderfamcstskvmaaaavlkksese pnllnqrveikksdlvnynpiaekhvngtmslaelsaaalqysdnvamnkliahvggpas vtafarqlgdetfrldrteptlntaipgdprdttspramaqtlrnltlgkalgdsqraql vtwmkgnttgaasiqaglpaswvvgdktgsggygttndiaviwpkdraplilvtyftqpq pkaesrrdvlasaakivtdg
Timeline for d7bh5a_: