Lineage for d6txih_ (6txi H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2703216Species Thermotoga maritima [TaxId:243274] [188168] (10 PDB entries)
  8. 2703224Domain d6txih_: 6txi H: [416886]
    automated match to d1vlga_
    complexed with fe, gol, lfa, so4

Details for d6txih_

PDB Entry: 6txi (more details), 1.76 Å

PDB Description: crystal structure of thermotoga maritima e65a ferritin
PDB Compounds: (H:) Ferritin

SCOPe Domain Sequences for d6txih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6txih_ a.25.1.1 (H:) automated matches {Thermotoga maritima [TaxId: 243274]}
mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
eyiyarggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre

SCOPe Domain Coordinates for d6txih_:

Click to download the PDB-style file with coordinates for d6txih_.
(The format of our PDB-style files is described here.)

Timeline for d6txih_:

  • d6txih_ is new in SCOPe 2.08-stable