SCOP 1.57: Domain d1an7a_: 1an7 A:

Lineage for d1an7a_ (1an7 A:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (3 species)

7. Species Thermus thermophilus [TaxId:274] [56051] (11 PDB entries)

8. Domain d1an7a_: 1an7 A: [41465]

Details for d1an7a_

PDB Entry: 1an7, 2.9 Å

PDB Description: ribosomal protein s8 from thermus thermophilus

SCOP Domain Sequences for d1an7a_:

Sequence; same for both SEQRES and ATOM records:

>d1an7a_ d.140.1.1 (A:) Ribosomal protein S8 {Thermus thermophilus}
tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy
lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr
earklgvggelicevw

Timeline for d1an7a_:

• d1an7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1an7a_ appears in SCOP 1.59
  
• d1an7a_ appears in the current release, SCOPe 2.08