Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (3 species) |
Species Thermus thermophilus [TaxId:274] [56051] (11 PDB entries) |
Domain d1an7a_: 1an7 A: [41465] |
PDB Entry: 1an7 (more details), 2.9 Å
SCOP Domain Sequences for d1an7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1an7a_ d.140.1.1 (A:) Ribosomal protein S8 {Thermus thermophilus} tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr earklgvggelicevw
Timeline for d1an7a_: