Lineage for d1an7a_ (1an7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978267Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2978268Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2978269Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2978270Protein Ribosomal protein S8 [56049] (4 species)
  7. 2978288Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 2978289Domain d1an7a_: 1an7 A: [41465]

Details for d1an7a_

PDB Entry: 1an7 (more details), 2.9 Å

PDB Description: ribosomal protein s8 from thermus thermophilus
PDB Compounds: (A:) ribosomal protein s8

SCOPe Domain Sequences for d1an7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1an7a_ d.140.1.1 (A:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy
lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr
earklgvggelicevw

SCOPe Domain Coordinates for d1an7a_:

Click to download the PDB-style file with coordinates for d1an7a_.
(The format of our PDB-style files is described here.)

Timeline for d1an7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1an7b_