Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) automatically mapped to Pfam PF00410 |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (4 species) |
Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries) Uniprot P24319 |
Domain d1an7a_: 1an7 A: [41465] |
PDB Entry: 1an7 (more details), 2.9 Å
SCOPe Domain Sequences for d1an7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1an7a_ d.140.1.1 (A:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]} tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr earklgvggelicevw
Timeline for d1an7a_: