Lineage for d1b7yb6 (1b7y B:191-399)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.138: B3/B4 domain of PheRS, PheT [56036] (1 superfamily) Superfamily d.138.1: B3/B4 domain of PheRS, PheT [56037] (1 family) 
Family d.138.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein) Protein B3/B4 domain of PheRS, PheT [56039] (1 species) Species Thermus thermophilus (Thermus aquaticus) [56040] (4 PDB entries) 
Domain d1b7yb6: 1b7y B:191-399 [41456]
Other proteins in same PDB: d1b7ya_, d1b7yb1, d1b7yb2, d1b7yb3, d1b7yb4, d1b7yb5
Details for d1b7yb6
PDB Entry: 1b7y (more details), 2.5 Å
PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate
SCOP Domain Sequences for d1b7yb6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7yb6 d.138.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus (Thermus aquaticus)}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk
SCOP Domain Coordinates for d1b7yb6:
Click to download the PDB-style file with coordinates for d1b7yb6.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b7yb6:
View in 3D
