Lineage for d1b7yb5 (1b7y B:475-681)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) 
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (11 proteins) 
Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species) Species Thermus thermophilus (Thermus aquaticus) [55704] (4 PDB entries) 
Domain d1b7yb5: 1b7y B:475-681 [40780]
Other proteins in same PDB: d1b7ya_, d1b7yb1, d1b7yb2, d1b7yb3, d1b7yb4, d1b7yb6
Details for d1b7yb5
PDB Entry: 1b7y (more details), 2.5 Å
PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate
SCOP Domain Sequences for d1b7yb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7yb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus (Thermus aquaticus)}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp
SCOP Domain Coordinates for d1b7yb5:
Click to download the PDB-style file with coordinates for d1b7yb5.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b7yb5:
View in 3D
