![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
![]() | Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) ![]() duplication: contains two domains of this fold |
![]() | Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins) |
![]() | Protein Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56016] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [56017] (12 PDB entries) |
![]() | Domain d1aopa4: 1aop A:426-570 [41426] Other proteins in same PDB: d1aopa1, d1aopa2 complexed with k, po4, sf4, srm |
PDB Entry: 1aop (more details), 1.6 Å
SCOPe Domain Sequences for d1aopa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aopa4 d.134.1.1 (A:426-570) Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 {Escherichia coli [TaxId: 562]} pqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivmrvtgcpngcgr amlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligrwakereag egfgdftvragiirpvldpardlwd
Timeline for d1aopa4: