Lineage for d1aopa2 (1aop A:346-425)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562266Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2562267Family d.58.36.1: Duplicated SiR/NiR-like domains 1 and 3 [55125] (3 proteins)
  6. 2562282Protein Sulfite reductase, domains 1 and 3 [55126] (1 species)
  7. 2562283Species Escherichia coli [TaxId:562] [55127] (12 PDB entries)
  8. 2562285Domain d1aopa2: 1aop A:346-425 [39502]
    Other proteins in same PDB: d1aopa3, d1aopa4
    complexed with k, po4, sf4, srm

Details for d1aopa2

PDB Entry: 1aop (more details), 1.6 Å

PDB Description: sulfite reductase structure at 1.6 angstrom resolution
PDB Compounds: (A:) sulfite reductase hemoprotein

SCOPe Domain Sequences for d1aopa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aopa2 d.58.36.1 (A:346-425) Sulfite reductase, domains 1 and 3 {Escherichia coli [TaxId: 562]}
igwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpe
sekakiekiakesglmnavt

SCOPe Domain Coordinates for d1aopa2:

Click to download the PDB-style file with coordinates for d1aopa2.
(The format of our PDB-style files is described here.)

Timeline for d1aopa2: