![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) ![]() duplication: contains two subdomains of this fold |
![]() | Family d.58.36.1: Duplicated SiR/NiR-like domains 1 and 3 [55125] (3 proteins) |
![]() | Protein Sulfite reductase, domains 1 and 3 [55126] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55127] (12 PDB entries) |
![]() | Domain d1aopa1: 1aop A:81-145 [39501] Other proteins in same PDB: d1aopa3, d1aopa4 complexed with k, po4, sf4, srm |
PDB Entry: 1aop (more details), 1.6 Å
SCOPe Domain Sequences for d1aopa1:
Sequence, based on SEQRES records: (download)
>d1aopa1 d.58.36.1 (A:81-145) Sulfite reductase, domains 1 and 3 {Escherichia coli [TaxId: 562]} llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilkknvkpvhqmlhsv gldal
>d1aopa1 d.58.36.1 (A:81-145) Sulfite reductase, domains 1 and 3 {Escherichia coli [TaxId: 562]} llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilpvhqmlhsvgldal
Timeline for d1aopa1: