SCOPe 2.03: Domain d1dmlg1: 1dml G:28-169

Lineage for d1dmlg1 (1dml G:28-169)

Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.131: DNA clamp [55978] (1 superfamily)
contains two helices and two beta sheets
duplication: fold has internal pseudo two-fold symmetry
Superfamily d.131.1: DNA clamp [55979] (3 families)
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
duplication: consists of two domains of this fold
Protein UL42 [55987] (1 species)
Species Human herpesvirus type 1 [TaxId:10298] [55988] (1 PDB entry)
Domain d1dmlg1: 1dml G:28-169 [41386]
protein/DNA complex

Details for d1dmlg1

PDB Entry: 1dml (more details), 2.7 Å

PDB Description: crystal structure of herpes simplex ul42 bound to the c-terminus of hsv pol

PDB Compounds: (G:) DNA polymerase processivity factor

SCOPe Domain Sequences for d1dmlg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmlg1 d.131.1.2 (G:28-169) UL42 {Human herpesvirus type 1 [TaxId: 10298]}
gapcqvvlqgaelngilqafaplrtslldsllvmgdrgilihntifgeqvflplehsqfs
ryrwrgptaaflslvdqkrsllsvfranqypdlrrvelaitgqapfrtlvqriwtttsdg
eavelasetlmkreltsfvvlv

SCOPe Domain Coordinates for d1dmlg1:

Click to download the PDB-style file with coordinates for d1dmlg1.
(The format of our PDB-style files is described here.)

Timeline for d1dmlg1: